PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.011G196400.1
Common NameB456_011G196400, LOC105776456
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARR-B
Protein Properties Length: 681aa    MW: 74631.9 Da    PI: 6.563
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.011G196400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.38.2e-29213266155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kpr++W+ eLH++Fv av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQkYRl
  Gorai.011G196400.1 213 KPRVVWSVELHQQFVAAVNQL-GIDKAVPKKILELMNVPGLTRENVASHLQKYRL 266
                         79*******************.********************************8 PP

2Response_reg75.22.4e-25351431109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         vl+vdD+p+ +++l+++l+   y +v+ +  +e al +l+e++  +D++l D+ mp+mdG++ll++i  e  +lp+i+++a + ++ + + 
  Gorai.011G196400.1  35 VLVVDDDPTCLMILEKMLTACLY-KVTKCNRAETALSKLRENKngYDIVLSDVHMPDMDGFKLLEHIGLEM-DLPVIMMSADDGKQVVMKG 123
                         89*****************9999.***************999999**********************6654.8****************** PP

                         HHTTESEEEESS--HHHHHH CS
        Response_reg  90 lkaGakdflsKpfdpeelvk 109
                         +  Ga d+l Kp+ +e+l +
  Gorai.011G196400.1 124 VTHGACDYLIKPVRIEALKN 143
                         ****************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363923.7E-1779672IPR017053Response regulator B-type, plant
SuperFamilySSF521725.98E-3532157IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23005.7E-4232174No hitNo description
SMARTSM004484.7E-3033145IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.49634149IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.1E-2235143IPR001789Signal transduction response regulator, receiver domain
CDDcd001566.06E-2736148No hitNo description
PROSITE profilePS5129411.048210269IPR017930Myb domain
SuperFamilySSF466893.58E-20210270IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-30212271IPR009057Homeodomain-like
TIGRFAMsTIGR015579.7E-25213266IPR006447Myb domain, plants
PfamPF002499.8E-8215265IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 681 aa     Download sequence    Send to blast
MNVSSVKGSM SISSSTSTWK AGDTISDQFP AGLRVLVVDD DPTCLMILEK MLTACLYKVT  60
KCNRAETALS KLRENKNGYD IVLSDVHMPD MDGFKLLEHI GLEMDLPVIM MSADDGKQVV  120
MKGVTHGACD YLIKPVRIEA LKNIWQHVVR KRKNEWKEFE QSGSVEEGDR QPKQSDDADY  180
SSSANEGNWK GSKRRKDEEE ETDERDDTST LKKPRVVWSV ELHQQFVAAV NQLGIDKAVP  240
KKILELMNVP GLTRENVASH LQKYRLYLRR LSGVSQHQSN LSTIISAQDP TFGSLSSLSG  300
LDLQTLAATG QLPAQSLARL QAAGLGRATA KSGIPITLVD QRNIFSFENP KLRFGEGQQQ  360
HMTNKQQVNL LHGIPTTMEA KQLVSLRHAA QSVGNMNMQV PPPGPQSSQN NPLLMQMGQQ  420
QQQQQSRGQI LVDSTINHAP RLSSMGQPIL SNGMATNVSS RNGIPENIRA PGYSQTPSML  480
NFPMNHASEL PGNCFPLGST PGVSNLTSKG AFQEDVNSEI KGSGGFMPSY DVFNDLNQHK  540
PQSWELQNVG IAFDSSQHSN SLQGNLDLTQ SALGQQGFSS GQMNGHNRSA AVASKAVFST  600
GDVKELRSAQ NVNQHLNNLL VDNTIRVKSE RVCDTSPANI FPDHFGQDDL MSALLKQQES  660
VASSENEFDF DGYSMNNIPV *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-22212272464ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ3934651e-84GQ393465.1 Gossypium hirsutum cultivar Deltapine 33 B clone MONCS0430 SSR marker CGR5416 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012454564.10.0PREDICTED: two-component response regulator ARR2-like isoform X1
SwissprotQ9ZWJ90.0ARR2_ARATH; Two-component response regulator ARR2
TrEMBLA0A0D2UVE10.0A0A0D2UVE1_G
STRINGGLYMA07G37220.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24032773
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.20.0response regulator 1
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]